Kaliotoxin-1 - 0.1 mg

>98% (HPLC)

KCa1.1 and some KV1 K+ channels

GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK.

Kaliotoxin-1 (#STK-370) is a highly pure, synthetic, and biologically active peptide toxin.

4149 Da

Kaliotoxin-1 is a potent inhibitor of large conductance Ca2+-activated K+ channels (BKCa)1,2. Kaliotoxin-1 also binds the dendrotoxin sensitive voltage-dependent K+ channels (KV1.1, KV1.2 and KV1.3 nM)3.

Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).

10-100 nM.

Lyophilized

K+ channel toxin α-KTx 3.1, KTX-1

Disulfide bonds between Cys8-Cys28, Cys14-Cys33, and Cys18-Cys35. Lys38 - C-terminal amidation.

C171H284N56O48S6.

145199-73-1

Up to one week at 4°C or three months at -20°C.