












32-34 KDa(Reducing)
EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

32-34 KDa(Reducing)










Fc is a crystallizable fragment composed of the carboxyl terminal of two kinds of immunoglobulin heavy chain, which is connected to each other by disulfide bond. The Fc fragment contains the carboxyl terminal part of the heavy chain fixation region, which is responsible for the effect function of immunoglobulin (complement fixation, binding to the cell membrane through Fc receptors, and placental transport). It is reported that IgG1 Fc, as a potential anti-inflammatory drug, plays a new role in the treatment of human autoimmune diseases.

Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
参考图片
Anti-His antibody Immobilized on CM5 Chip captured CD16b(NA1) His Tag, Human (Cat. No. UA020006), can bind IgG1-Fc (UA050001) with an affinity constant of 9.237 μM as determined in SPR assay (Biacore T200).
IgG1 Fc, Human ,2μg on SDS-PAGE under reducing and Non-reducing condition. The purity is greater than 95%.
Immobilized Biotinylated FcγRIIa/CD32a(H167) Avi&His Tag, Human (Cat. No. UA010430) at 2 μg/mL on Streptavidin precoated (0.5μg/well) plate, can bind IgG1 Fc, Human (Cat. No. UA050001) with EC50 of 0.38-0.44 μg/ml.
Immobilized Biotinylated FcγRIIA/CD32a(R167) His&Avi Tag, Human(Cat. No. UA010748) at 2 μg/mL on Streptavidin precoated (0.5μg/well) plate, can bind IgG1 Fc, Human (Cat. No. UA050001) with EC50 of 0.37-0.48 μg/ml.
Immobilized Biotinylated Fc γ RIIIa/CD16a(V176) Avi&His Tag Protein, Human (Cat. No. UA010763) at 2 μg/mL on Streptavidin precoated (0.5μg/well) plate, can bind IgG1 Fc Protein, Human (Cat. No. UA050001) with EC50 of 0.46-1.14μg/ml.