Maurotoxin - 0.5 mg

>99% (HPLC)

KCa and KV1 K+ channels

VSCTGSKDCYAPCRKQTGCPNAKCINKSCKCYGC.

Maurotoxin (#STM-340) is a highly pure, synthetic, and biologically active peptide toxin.

3612 Da

Maurotoxin activity was extensively assayed on a large array of K+ channels, including KCa (KCa1.1, KCa2.1, KCa2.2, KCa2.2, KCa3.1), KCNA (KCNA1, KCNA2 and KCNA3) and Shaker-B K+ currents and seems to be very potent blocker of either KCa3.1 and KCNA2 channels1.

Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).

1-200 nM.

Lyophilized

K+ channel toxin α-KTx 6.2, MTX

Disulfide bonds between Cys3-Cys24, Cys9-Cys29, Cys13-Cys19 and Cys31-Cys34. Cys34 - C-terminal amidation.

C145H232N46O46S8.

Up to two weeks at 4°C or three months at -20°C.